Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL

Name: Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL
Address: 5143 S Lakeland Dr #2, Lakeland, FL, 33813, US
Telephone: +1 (863) 900-2081
Price range: $$
Rating: 5

5.0(60 reviews)Updated: 09/02/2026

Address

5143 S Lakeland Dr #2, Lakeland, FL 33813

Call

+1 (863) 900-2081

Website

medspaandwellnesscliniclakelandfl.com

Hours

Overview

MedSpa and Wellness Clinic Of Lakeland FL is a premier wellness clinic specializing in hormone replacement therapy and integrative health. Led by Oneida Cadavid, MSNA, APRN, CRNA—with over 24 years of experience—our team delivers personalized, root-cause–focused care. We offer customized HRT regimens, NAD⁺ therapy, peptide treatments, IV nutrient drips, GLP-1–based weight-loss programs, and lab testing. Utilizing advanced diagnostics and continuous monitoring, we craft individualized plans that balance hormones, boost energy, support immune function, and enhance vitality. We empower clients with education, support, and holistic care throughout their wellness journey for lasting results. Experience the Serenity difference today.

Treatments / Services Offered

Services

Dermal Filler Laser Treatments Skin Treatment

Brands

Botox

Map

Is this your clinic?

Claim this free profile to update your info, add photos and your full service menu, and respond to patient inquiries.

Claim this profileFree · Takes about a minute

Practice notes

Amenities

Wheelchair accessible entrance

Wheelchair accessible parking lot

Onsite services

Payment

Credit cards

Debit cards

NFC mobile payments

FAQs

What treatments does Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL offer?

Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL offers 3 services: Dermal Filler, Laser Treatments, Skin Treatment. Brands offered include Botox. See the full list in the treatments section on this page.

How is Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL rated?

Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL has a 5.0 star rating based on 60 patient reviews.

Where is Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL located?

Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL is located at 5143 S Lakeland Dr #2, Lakeland, FL 33813. See the hours of operation on this page before you visit.

Report an issue with this listing

Other clinics in Lakeland